I need to display character difference per line in a unix unified diff like style. Is there a way to do that using difflib?
I can get "unified diff" and "character per line diff" separately using difflib.unified_diff and difflib.Differ() (ndiff) respectively, but how can I combine them?
This is what I am looking for:
#
# This is difflib.unified
#
>>> print ''.join(difflib.unified_diff('one\ntwo\nthree\n'.splitlines(1), 'ore\ntree\nemu\n'.splitlines(1), 'old', 'new'))
--- old
+++ new
## -1,3 +1,3 ##
-one
-two
-three
+ore
+tree
+emu
>>>
#
# This is difflib.Differ
#
>>> print ''.join(difflib.ndiff('one\ntwo\nthree\n'.splitlines(1), 'ore\ntree\nemu\n'.splitlines(1))),
- one
? ^
+ ore
? ^
- two
- three
? -
+ tree
+ emu
>>>
#
# I want the merge of above two, something like this...
#
>>> print ''.join(unified_with_ndiff('one\ntwo\nthree\n'.splitlines(1), 'ore\ntree\nemu\n'.splitlines(1))),
--- old
+++ new
## -1,3 +1,3 ##
- one
? ^
+ ore
? ^
- two
- three
? -
+ tree
+ emu
>>>
Found the answer on my own after digging into the source code of difflib.
'''
# mydifflib.py
#author: Amit Barik
#summary: Overrides difflib.Differ to present the user with unified format (for Python 2.7).
Its basically merging of difflib.unified_diff() and difflib.Differ.compare()
'''
from difflib import SequenceMatcher
from difflib import Differ
class UnifiedDiffer(Differ):
def unified_diff(self, a, b, fromfile='', tofile='', fromfiledate='',
tofiledate='', n=3, lineterm='\n'):
r"""
Compare two sequences of lines; generate the resulting delta, in unified
format
Each sequence must contain individual single-line strings ending with
newlines. Such sequences can be obtained from the `readlines()` method
of file-like objects. The delta generated also consists of newline-
terminated strings, ready to be printed as-is via the writeline()
method of a file-like object.
Example:
>>> print ''.join(Differ().unified_diff('one\ntwo\nthree\n'.splitlines(1),
... 'ore\ntree\nemu\n'.splitlines(1)),
... 'old.txt', 'new.txt', 'old-date', 'new-date'),
--- old.txt old-date
+++ new.txt new-date
## -1,5 +1,5 ##
context1
- one
? ^
+ ore
? ^
- two
- three
? -
+ tree
+ emu
context2
"""
started = False
for group in SequenceMatcher(None,a,b).get_grouped_opcodes(n):
if not started:
fromdate = '\t%s' % fromfiledate if fromfiledate else ''
todate = '\t%s' % tofiledate if tofiledate else ''
yield '--- %s%s%s' % (fromfile, fromdate, lineterm)
yield '+++ %s%s%s' % (tofile, todate, lineterm)
started = True
i1, i2, j1, j2 = group[0][1], group[-1][2], group[0][3], group[-1][4]
yield "## -%d,%d +%d,%d ##%s" % (i1+1, i2-i1, j1+1, j2-j1, lineterm)
for tag, i1, i2, j1, j2 in group:
if tag == 'replace':
for line in a[i1:i2]:
g = self._fancy_replace(a, i1, i2, b, j1, j2)
elif tag == 'equal':
for line in a[i1:i2]:
g = self._dump(' ', a, i1, i2)
if n > 0:
for line in g:
yield line
continue
elif tag == 'delete':
for line in a[i1:i2]:
g = self._dump('-', a, i1, i2)
elif tag == 'insert':
for line in b[j1:j2]:
g = self._dump('+', b, j1, j2)
else:
raise ValueError, 'unknown tag %r' % (tag,)
for line in g:
yield line
def main():
# Test
a ='context1\none\ntwo\nthree\ncontext2\n'.splitlines(1)
b = 'context1\nore\ntree\nemu\ncontext2\n'.splitlines(1)
x = UnifiedDiffer().unified_diff(a, b, 'old.txt', 'new.txt', 'old-date', 'new-date', n=1)
print ''.join(x)
if __name__ == '__main__':
main()
Related
Using a Korean Input Method Editor (IME), it's possible to type 버리 + 어 and it will automatically become 버려.
Is there a way to programmatically do that in Python?
>>> x, y = '버리', '어'
>>> z = '버려'
>>> ord(z[-1])
47140
>>> ord(x[-1]), ord(y)
(47532, 50612)
Is there a way to compute that 47532 + 50612 -> 47140?
Here's some more examples:
가보 + 아 -> 가봐
끝나 + ㄹ -> 끝날
I'm a Korean. First, if you type 버리 + 어, it becomes 버리어 not 버려. 버려 is an abbreviation of 버리어 and it's not automatically generated. Also 가보아 cannot becomes 가봐 automatically during typing by the same reason.
Second, by contrast, 끝나 + ㄹ becomes 끝날 because 나 has no jongseong(종성). Note that one character of Hangul is made of choseong(초성), jungseong(중성), and jongseong. choseong and jongseong are a consonant, jungseong is a vowel. See more at Wikipedia. So only when there's no jongseong during typing (like 끝나), there's a chance that it can have jongseong(ㄹ).
If you want to make 버리 + 어 to 버려, you should implement some Korean language grammar like, especially for this case, abbreviation of jungseong. For example ㅣ + ㅓ = ㅕ, ㅗ + ㅏ = ㅘ as you provided. 한글 맞춤법 chapter 4. section 5 (I can't find English pages right now) defines abbreviation like this. It's possible, but not so easy job especially for non-Koreans.
Next, if what you want is just to make 끝나 + ㄹ to 끝날, it can be a relatively easy job since there're libraries which can handle composition and decomposition of choseong, jungseong, jongseong. In case of Python, I found hgtk. You can try like this (nonpractical code):
# hgtk methods take one character at a time
cjj1 = hgtk.letter.decompose('나') # ('ㄴ', 'ㅏ', '')
cjj2 = hgtk.letter.decompose('ㄹ') # ('ㄹ', '', '')
if cjj1[2]) == '' and cjj2[1]) == '':
cjj = (cjj1[0], cjj1[1], cjj2[0])
cjj2 = None
Still, without proper knowledge of Hangul, it will be very hard to get it done.
You could use your own Translation table.
The drawback is you have to input all pairs manual or you have a file to get it from.
For instance:
# Sample Korean chars to map
k = [[('버리', '어'), ('버려')], [('가보', '아'), ('가봐')], [('끝나', 'ㄹ'), ('끝날')]]
class Korean(object):
def __init__(self):
self.map = {}
for m in k:
key = m[0][0] + m[0][1]
self.map[hash(key)] = m[1]
def __getitem__(self, item):
return self.map[hash(item)]
def translate(self, s):
return [ self.map[hash(token)] for token in s]
if __name__ == '__main__':
k_map = Korean()
k_chars = [ m[0][0] + m[0][1] for m in k]
print('Input: %s' % k_chars)
print('Output: %s' % k_map.translate(k_chars))
one_char_3 = k[0][0][0] + k[0][0][1]
print('%s = %s' % (one_char_3, k_map[ one_char_3 ]) )
Input: ['버리어', '가보아', '끝나ㄹ']
Output: ['버려', '가봐', '끝날']
버리어 = 버려
Tested with Python:3.4.2
I want to compare two strings in a python unittest which contain html.
Is there a method which outputs the result in a human friendly (diff like) version?
A simple method is to strip whitespace from the HTML and split it into a list. Python 2.7's unittest (or the backported unittest2) then gives a human-readable diff between the lists.
import re
def split_html(html):
return re.split(r'\s*\n\s*', html.strip())
def test_render_html():
expected = ['<div>', '...', '</div>']
got = split_html(render_html())
self.assertEqual(expected, got)
If I'm writing a test for working code, I usually first set expected = [], insert a self.maxDiff = None before the assert and let the test fail once. The expected list can then be copy-pasted from the test output.
You might need to tweak how whitespace is stripped depending on what your HTML looks like.
I submitted a patch to do this some years back. The patch was rejected but you can still view it on the python bug list.
I doubt you would want to hack your unittest.py to apply the patch (if it even still works after all this time), but here's the function for reducing two strings a manageable size while still keeping at least part of what differs. So long as all you didn't want the complete differences this might be what you want:
def shortdiff(x,y):
'''shortdiff(x,y)
Compare strings x and y and display differences.
If the strings are too long, shorten them to fit
in one line, while still keeping at least some difference.
'''
import difflib
LINELEN = 79
def limit(s):
if len(s) > LINELEN:
return s[:LINELEN-3] + '...'
return s
def firstdiff(s, t):
span = 1000
for pos in range(0, max(len(s), len(t)), span):
if s[pos:pos+span] != t[pos:pos+span]:
for index in range(pos, pos+span):
if s[index:index+1] != t[index:index+1]:
return index
left = LINELEN/4
index = firstdiff(x, y)
if index > left + 7:
x = x[:left] + '...' + x[index-4:index+LINELEN]
y = y[:left] + '...' + y[index-4:index+LINELEN]
else:
x, y = x[:LINELEN+1], y[:LINELEN+1]
left = 0
cruncher = difflib.SequenceMatcher(None)
xtags = ytags = ""
cruncher.set_seqs(x, y)
editchars = { 'replace': ('^', '^'),
'delete': ('-', ''),
'insert': ('', '+'),
'equal': (' ',' ') }
for tag, xi1, xi2, yj1, yj2 in cruncher.get_opcodes():
lx, ly = xi2 - xi1, yj2 - yj1
edits = editchars[tag]
xtags += edits[0] * lx
ytags += edits[1] * ly
# Include ellipsis in edits line.
if left:
xtags = xtags[:left] + '...' + xtags[left+3:]
ytags = ytags[:left] + '...' + ytags[left+3:]
diffs = [ x, xtags, y, ytags ]
if max([len(s) for s in diffs]) < LINELEN:
return '\n'.join(diffs)
diffs = [ limit(s) for s in diffs ]
return '\n'.join(diffs)
Maybe this is a quite 'verbose' solution. You could add a new 'equality function' for your user defined type (e.g: HTMLString) which you have to define first:
class HTMLString(str):
pass
Now you have to define a type equality function:
def assertHTMLStringEqual(first, second):
if first != second:
message = ... # TODO here: format your message, e.g a diff
raise AssertionError(message)
All you have to do is format your message as you like. You can also use a class method in your specific TestCase as a type equality function. This gives you more functionality to format your message, since unittest.TestCase does this a lot.
Now you have to register this equality function in your unittest.TestCase:
...
def __init__(self):
self.addTypeEqualityFunc(HTMLString, assertHTMLStringEqual)
The same for a class method:
...
def __init__(self):
self.addTypeEqualityFunc(HTMLString, 'assertHTMLStringEqual')
And now you can use it in your tests:
def test_something(self):
htmlstring1 = HTMLString(...)
htmlstring2 = HTMLString(...)
self.assertEqual(htmlstring1, htmlstring2)
This should work well with python 2.7.
I (the one asking this question) use BeautfulSoup now:
def assertEqualHTML(string1, string2, file1='', file2=''):
u'''
Compare two unicode strings containing HTML.
A human friendly diff goes to logging.error() if there
are not equal, and an exception gets raised.
'''
from BeautifulSoup import BeautifulSoup as bs
import difflib
def short(mystr):
max=20
if len(mystr)>max:
return mystr[:max]
return mystr
p=[]
for mystr, file in [(string1, file1), (string2, file2)]:
if not isinstance(mystr, unicode):
raise Exception(u'string ist not unicode: %r %s' % (short(mystr), file))
soup=bs(mystr)
pretty=soup.prettify()
p.append(pretty)
if p[0]!=p[1]:
for line in difflib.unified_diff(p[0].splitlines(), p[1].splitlines(), fromfile=file1, tofile=file2):
logging.error(line)
raise Exception('Not equal %s %s' % (file1, file2))
I wrote what I thought was a straightforward Python script to traverse a given directory and tabulate all the file suffixes it finds. The output looks like this:
OTUS-ASIO:face fish$ sufs
>>> /Users/fish/Dropbox/ost2/face (total 194)
=== 1 1 -
=== css 16 -----
=== gif 14 -----
=== html 12 ----
=== icc 87 --------------------------
=== jpg 3 -
=== js 46 --------------
=== png 3 -
=== zip 2 -
... which would be great, if those values were correct. They are not. Here's what happens when I run it in a subdirectory of the directory I listed above:
OTUS-ASIO:face fish$ cd images/
OTUS-ASIO:images fish$ sufs
>>> /Users/fish/Dropbox/ost2/face/images (total 1016)
=== JPG 3 -
=== gif 17 -
=== ico 1 -
=== jpeg 1 -
=== jpg 901 --------------------------
=== png 87 ---
... It only seems to go one directory level down. Running the script one level up didn't pick up on the 'jpeg' suffix at all, and seemed to miss a good 898 jpg files.
The script in question is here:
#!/usr/bin/env python
# encoding: utf-8
"""
getfilesuffixes.py
Created by FI$H 2000 on 2010-10-15.
Copyright (c) 2010 OST, LLC. All rights reserved.
"""
import sys, os, getopt
help_message = '''
Prints a list of all the file suffixes found in each DIR, with counts.
Defaults to the current directory wth no args.
$ %s DIR [DIR DIR etc ...]
''' % os.path.basename(__file__)
dirs = dict()
skips = ('DS_Store','hgignore')
class Usage(Exception):
def __init__(self, msg):
self.msg = msg
def getmesomesuffixes(rootdir, thisdir=None):
if not thisdir:
thisdir = rootdir
for thing in [os.path.abspath(h) for h in os.listdir(thisdir)]:
if os.path.isdir(thing):
getmesomesuffixes(rootdir), thing)
else:
if thing.rfind('.') > -1:
suf = thing.rsplit('.').pop()
dirs[rootdir][suf] = dirs[rootdir].get(suf, 0) + 1
return
def main(argv=None):
if argv is None:
argv = sys.argv
try:
try:
opts, args = getopt.getopt(argv[1:], "h", ["help",])
except getopt.error, msg:
raise Usage(msg)
for option, value in opts:
if option == "-v":
verbose = True
if option in ("-h", "--help"):
raise Usage(help_message)
if len(args) == 0:
args.append(os.getcwd())
for durr in [os.path.abspath(arg) for arg in args]:
if os.path.isdir(durr):
dirs[durr] = dict()
for k, v in dirs.items():
getmesomesuffixes(k)
print ""
for k, v in dirs.items():
sufs = v.items()
sufs.sort()
maxcount = reduce(lambda fs, ns: fs > ns and fs or ns, map(lambda t: t[1], sufs), 1)
mincount = reduce(lambda fs, ns: fs < ns and fs or ns, map(lambda t: t[1], sufs), 1)
total = reduce(lambda fs, ns: fs + ns, map(lambda t: t[1], sufs), 0)
print ">>>\t\t\t%s (total %s)" % (k, total)
for suf, sufcount in sufs:
try:
skips.index(suf)
except ValueError:
print "===\t\t\t%12s\t %3s\t %s" % (suf, sufcount, "-" * (int(float(float(sufcount) / float(maxcount)) * 25) + 1))
print ""
except Usage, err:
print >> sys.stderr, sys.argv[0].split("/")[-1] + ": " + str(err.msg)
print >> sys.stderr, "\t for help use --help"
return 2
if __name__ == "__main__":
sys.exit(main())
It seems that getmesomesuffixes() is subtly not doing what I want it to. I hate to ask such an annoying question, but if anyone can spot whatever amateur-hour error I am making with a quick once-over, it would save me some serious frustration.
Yeah, Won't you be better off if you used os.walk
for root, dirs, files in os.walk(basedir):
... do you stuff ..
See the example at
http://docs.python.org/library/os.html
Also look at os.path.splitext(path), a finer way to find the type of your file.
>>> os.path.splitext('/d/c/as.jpeg')
('/d/c/as', '.jpeg')
>>>
Both of these together should simplify your code.
import os
import os.path
from collections import defaultdict
def foo(dir='.'):
d = defaultdict(int)
for _, _, files in os.walk(dir):
for f in files:
d[os.path.splitext(f)[1]] += 1
return d
if __name__ == '__main__':
d = foo()
for k, v in sorted(d.items()):
print k, v
This question already has answers here:
How to convert raw javascript object to a dictionary?
(6 answers)
Closed 9 months ago.
I have a such text to load: https://sites.google.com/site/iminside1/paste
I'd prefer to create a python dictionary from it, but any object is OK. I tried pickle, json and eval, but didn't succeeded. Can you help me with this?
Thanks!
The results:
a = open("the_file", "r").read()
json.loads(a)
ValueError: Expecting property name: line 1 column 1 (char 1)
pickle.loads(a)
KeyError: '{'
eval(a)
File "<string>", line 19
from: {code: 'DME', airport: "Домодедово", city: 'Москва', country: 'Россия', terminal: ''},
^
SyntaxError: invalid syntax
Lifted almost straight from the pyparsing examples page:
# read text from web page
import urllib
page = urllib.urlopen("https://sites.google.com/site/iminside1/paste")
html = page.read()
page.close()
start = html.index("<pre>")+len("<pre>")+3 #skip over 3-byte header
end = html.index("</pre>")
text = html[start:end]
print text
# parse dict-like syntax
from pyparsing import (Suppress, Regex, quotedString, Word, alphas,
alphanums, oneOf, Forward, Optional, dictOf, delimitedList, Group, removeQuotes)
LBRACK,RBRACK,LBRACE,RBRACE,COLON,COMMA = map(Suppress,"[]{}:,")
integer = Regex(r"[+-]?\d+").setParseAction(lambda t:int(t[0]))
real = Regex(r"[+-]?\d+\.\d*").setParseAction(lambda t:float(t[0]))
string_ = Word(alphas,alphanums+"_") | quotedString.setParseAction(removeQuotes)
bool_ = oneOf("true false").setParseAction(lambda t: t[0]=="true")
item = Forward()
key = string_
dict_ = LBRACE - Optional(dictOf(key+COLON, item+Optional(COMMA))) + RBRACE
list_ = LBRACK - Optional(delimitedList(item)) + RBRACK
item << (real | integer | string_ | bool_ | Group(list_ | dict_ ))
result = item.parseString(text,parseAll=True)[0]
print result.data[0].dump()
print result.data[0].segments[0].dump(indent=" ")
print result.data[0].segments[0].flights[0].dump(indent=" - ")
print result.data[0].segments[0].flights[0].flightLegs[0].dump(indent=" - - ")
for seg in result.data[6].segments:
for flt in seg.flights:
fltleg = flt.flightLegs[0]
print "%(airline)s %(airlineCode)s %(flightNo)s" % fltleg,
print "%s -> %s" % (fltleg["from"].code, fltleg["to"].code)
Prints:
[['index', 0], ['serviceClass', '??????'], ['prices', [3504, ...
- eTicketing: true
- index: 0
- prices: [3504, 114.15000000000001, 89.769999999999996]
- segments: [[['indexSegment', 0], ['stopsCount', 0], ['flights', ...
- serviceClass: ??????
[['indexSegment', 0], ['stopsCount', 0], ['flights', [[['index', 0], ...
- flights: [[['index', 0], ['time', 'PT2H45M'], ['minAvailSeats', 9], ...
- indexSegment: 0
- stopsCount: 0
- [['index', 0], ['time', 'PT2H45M'], ['minAvailSeats', 9], ['flight...
- - flightLegs: [[['flightNo', '309'], ['eTicketing', 'true'], ['air...
- - index: 0
- - minAvailSeats: 9
- - stops: []
- - time: PT2H45M
- - [['flightNo', '309'], ['eTicketing', 'true'], ['airplane', 'Boe...
- - - airline: ?????????
- - - airlineCode: UN
- - - airplane: Boeing 737-500
- - - availSeats: 9
- - - classCode: I
- - - eTicketing: true
- - - fareBasis: IPROW
- - - flightClass: ECONOMY
- - - flightNo: 309
- - - from: - - [['code', 'DME'], ['airport', '??????????'], ...
- - - airport: ??????????
- - - city: ??????
- - - code: DME
- - - country: ??????
- - - terminal:
- - - fromDate: 2010-10-15
- - - fromTime: 10:40:00
- - - time:
- - - to: - - [['code', 'TXL'], ['airport', 'Berlin-Tegel'], ...
- - - airport: Berlin-Tegel
- - - city: ??????
- - - code: TXL
- - - country: ????????
- - - terminal:
- - - toDate: 2010-10-15
- - - toTime: 11:25:00
airBaltic BT 425 SVO -> RIX
airBaltic BT 425 SVO -> RIX
airBaltic BT 423 SVO -> RIX
airBaltic BT 423 SVO -> RIX
EDIT: fixed grouping and expanded output dump to show how to access individual key fields of results, either by index (within list) or as attribute (within dict).
If you really have to load the bulls... this data is (see my comment), you's propably best of with a regex adding missing quotes. Something like r"([a-zA-Z_][a-zA-Z_0-9]*)\s*\:" to find things to quote and r"\'\1\'\:" as replacement (off the top of my head, I have to test it first).
Edit: After some troulbe with backward-references in Python 3.1, I finally got it working with these:
>>> pattern = r"([a-zA-Z_][a-zA-Z_0-9]*)\s*\:"
>>> test = '{"foo": {bar: 1}}'
>>> repl = lambda match: '"{}":'.format(match.group(1))
>>> eval(re.sub(pattern, repl, test))
{'foo': {'bar': 1}}
Till now with help of delnan and a little investigation I can load it into dict with eval:
pattern = r"\b(?P<word>\w+):"
x = re.sub(pattern, '"\g<word>":',open("the_file", "r").read())
y = x.replace("true", '"true"')
d = eval(y)
Still looking for more efficient and maybe simpler solution.. I don't like to use "eval" for some reasons.
Extension of the DominiCane's version:
import re
quote_keys_regex = re.compile(r'([\{\s,])(\w+)(:)')
def js_variable_to_python(js_variable):
"""Convert a javascript variable into JSON and then load the value"""
# when in_string is not None, it contains the character that has opened the string
# either simple quote or double quote
in_string = None
# cut the string:
# r"""{ a:"f\"irst", c:'sec"ond'}"""
# becomes
# ['{ a:', '"', 'f\\', '"', 'irst', '"', ', c:', "'", 'sec', '"', 'ond', "'", '}']
l = re.split(r'(["\'])', js_variable)
# previous part (to check the escape character antislash)
previous_p = ""
for i, p in enumerate(l):
# parse characters inside a ECMA string
if in_string:
# we are in a JS string: replace the colon by a temporary character
# so quote_keys_regex doesn't have to deal with colon inside the JS strings
l[i] = l[i].replace(':', chr(1))
if in_string == "'":
# the JS string is delimited by simple quote.
# This is not supported by JSON.
# simple quote delimited string are converted to double quote delimited string
# here, inside a JS string, we escape the double quote
l[i] = l[i].replace('"', r'\"')
# deal with delimieters and escape character
if not in_string and p in ('"', "'"):
# we are not in string
# but p is double or simple quote
# that's the start of a new string
# replace simple quote by double quote
# (JSON doesn't support simple quote)
l[i] = '"'
in_string = p
continue
if p == in_string:
# we are in a string and the current part MAY close the string
if len(previous_p) > 0 and previous_p[-1] == '\\':
# there is an antislash just before: the JS string continue
continue
# the current p close the string
# replace simple quote by double quote
l[i] = '"'
in_string = None
# update previous_p
previous_p = p
# join the string
s = ''.join(l)
# add quote arround the key
# { a: 12 }
# becomes
# { "a": 12 }
s = quote_keys_regex.sub(r'\1"\2"\3', s)
# replace the surogate character by colon
s = s.replace(chr(1), ':')
# load the JSON and return the result
return json.loads(s)
It deals only with int, null and string. I don't know about float.
Note that the usage chr(1): the code doesn't work if this character in js_variable.
I have a for loop which references a dictionary and prints out the value associated with the key. Code is below:
for i in data:
if i in dict:
print dict[i],
How would i format the output so a new line is created every 60 characters? and with the character count along the side for example:
0001
MRQLLLISDLDNTWVGDQQALEHLQEYLGDRRGNFYLAYATGRSYHSARELQKQVGLMEP
0061
DYWLTAVGSEIYHPEGLDQHWADYLSEHWQRDILQAIADGFEALKPQSPLEQNPWKISYH
0121 LDPQACPTVIDQLTEMLKETGIPVQVIFSSGKDVDLLPQRSNKGNATQYLQQHLAMEPSQ
It's a finicky formatting problem, but I think the following code:
import sys
class EveryN(object):
def __init__(self, n, outs):
self.n = n # chars/line
self.outs = outs # output stream
self.numo = 1 # next tag to write
self.tll = 0 # tot chars on this line
def write(self, s):
while True:
if self.tll == 0: # start of line: emit tag
self.outs.write('%4.4d ' % self.numo)
self.numo += self.n
# wite up to N chars/line, no more
numw = min(len(s), self.n - self.tll)
self.outs.write(s[:numw])
self.tll += numw
if self.tll >= self.n:
self.tll = 0
self.outs.write('\n')
s = s[numw:]
if not s: break
if __name__ == '__main__':
sys.stdout = EveryN(60, sys.stdout)
for i, a in enumerate('abcdefgh'):
print a*(5+ i*5),
shows how to do it -- the output when running for demonstration purposes as the main script (five a's, ten b's, etc, with spaces in-between) is:
0001 aaaaa bbbbbbbbbb ccccccccccccccc dddddddddddddddddddd eeeeee
0061 eeeeeeeeeeeeeeeeeee ffffffffffffffffffffffffffffff ggggggggg
0121 gggggggggggggggggggggggggg hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
0181 hhhhhhh
# test data
data = range(10)
the_dict = dict((i, str(i)*200) for i in range( 10 ))
# your loops as a generator
lines = ( the_dict[i] for i in data if i in the_dict )
def format( line ):
def splitter():
k = 0
while True:
r = line[k:k+60] # take a 60 char block
if r: # if there are any chars left
yield "%04d %s" % (k+1, r) # format them
else:
break
k += 60
return '\n'.join(splitter()) # join all the numbered blocks
for line in lines:
print format(line)
I haven't tested it on actual data, but I believe the code below would do the job. It first builds up the whole string, then outputs it a 60-character line at a time. It uses the three-argument version of range() to count by 60.
s = ''.join(dict[i] for i in data if i in dict)
for i in range(0, len(s), 60):
print '%04d %s' % (i+1, s[i:i+60])
It seems like you're looking for textwrap
The textwrap module provides two convenience functions, wrap() and
fill(), as well as TextWrapper, the class that does all the work, and
a utility function dedent(). If you’re just wrapping or filling one or
two text strings, the convenience functions should be good enough;
otherwise, you should use an instance of TextWrapper for efficiency.