i have
string = 'Server:xxx-zzzzzzzzz.eeeeeeeeeee.frPIPELININGSIZE'
i need a python regex expression to identify xxx-zzzzzzzzz.eeeeeeeeeee.fr to do a sub-string function to it
Expected output :
string : 'Server:PIPELININGSIZE'
the URL is inside a string, i tried a lot of regex expressions
Not sure if this helps, because your question was quite vaguely formulated. :)
import re
string = 'Server:xxx-zzzzzzzzz.eeeeeeeeeee.frPIPELININGSIZE'
string_1 = re.search('[a-z.-]+([A-Z]+)', string).group(1)
print(f'string: Server:{string_1}')
Output:
string: Server:PIPELININGSIZE
No regex. single line use just to split on your target word.
string = 'Server:xxx-zzzzzzzzz.eeeeeeeeeee.frPIPELININGSIZE'
last = string.split("fr",1)[1]
first =string[:string.index(":")]
print(f'{first} : {last}')
Gives #
Server:PIPELININGSIZE
The wording of the question suggests that you wish to find the hostname in the string, but the expected output suggests that you want to remove it. The following regular expression will create a tuple and allow you to do either.
import re
str = "Server:xxx-zzzzzzzzz.eeeeeeeeeee.frPIPELININGSIZE"
p = re.compile('^([A-Za-z]+[:])(.*?)([A-Z]+)$')
m = re.search(p, str)
result = m.groups()
# ('Server:', 'xxx-zzzzzzzzz.eeeeeeeeeee.fr', 'PIPELININGSIZE')
Remove the hostname:
print(f'{result[0]} {result[2]}')
# Output: 'Server: PIPELININGSIZE'
Extract the hostname:
print(result[1])
# Output: 'xxx-zzzzzzzzz.eeeeeeeeeee.fr'
I have a string that contains some words in the >>number format.
For example:
this is a sentence >>82384324
I need a way to match those >>numbers and replace it with another string that contains the number.
For example: >>342 becomes
this is a string that contains the number 342
s= "this is a sentence >>82384324"
print re.sub("(.*\>\>)","This is a string containing " ,s)
This is a string containing 82384324
Assuming you are going to run into multiple number occurrences in a string I would suggest something a little more robust such as:
import re
pattern = re.compile('>>(\d+)')
str = "sadsaasdsa >>353325233253 Frank >>352523523"
search = re.findall(pattern, str)
for each in search:
print "The string contained the number %s" % each
Which yields:
>>The string contained the number 353325233253
>>The string contained the number 352523523
Using this basic pattern should work:
>>(\d+)
code:
import re
str = "this is a sentence >>82384324"
rep = "which contains the number \\1"
pat = ">>(\\d+)"
res = re.sub(pat, rep, str)
print(res)
example: http://regex101.com/r/kK3tL8
One simple way, assuming the only place you find ">>" is before a number, is to replace just those:
>>> mystr = "this is a sentence >>82384324"
>>> mystr.replace(">>","this is a string that contains the number ")
'this is a sentence this is a string that contains the number 82384324'
If there are other examples of >> in the text that you don't want to replace, you will need to catch the number as well, and it'll be best to use a regular expression.
>>> import re
>>> re.sub('>>(\d+)','this is a string that contains the number \g<1>',mystr)
'this is a sentence this is a string that contains the number 82384324'
https://docs.python.org/2/library/re.html and https://docs.python.org/2/howto/regex.html can provide more information about regular expressions.
You can do this using :
sentence = 'Stringwith>>1221'
print 'This is a string that contains
the number %s' % (re.search('>>(\d+)',sentence).group(1))
Result :
This is a string that contains the number 1221
You can look to the findall option to get all numbers that match the pattern here
I have a lot of long strings - not all of them have the same length and content, so that's why I can't use indices - and I want to extract a string from all of them. This is what I want to extract:
http://www.someDomainName.com/anyNumber
SomeDomainName doesn't contain any numbers and and anyNumber is different in each long string. The code should extract the desired string from any string possible and should take into account spaces and any other weird thing that might appear in the long string - should be possible with regex right? -. Could anybody help me with this? Thank you.
Update: I should have said that www. and .com are always the same. Also someDomainName! But there's another http://www. in the string
import re
results = re.findall(r'\bhttp://www\.someDomainName\.com/\d+\b', long_string)
>>> import re
>>> pattern = re.compile("(http://www\\.)(\\w*)(\\.com/)(\\d+)")
>>> matches = pattern.search("http://www.someDomainName.com/2134")
>>> if matches:
print matches.group(0)
print matches.group(1)
print matches.group(2)
print matches.group(3)
print matches.group(4)
http://www.someDomainName.com/2134
http://www.
someDomainName
.com/
2134
In the above pattern, we have captured 5 groups -
One is the complete string that is matched
Rest are in the order of the brackets you see.. (So, you are looking for the second one..) - (\\w*)
If you want, you can capture only the part of the string you are interested in.. So, you can remove the brackets from rest of the pattern that you don't want and just keep (\w*)
>>> pattern = re.compile("http://www\\.(\\w*)\\.com/\\d+")
>>> matches = patter.search("http://www.someDomainName.com/2134")
>>> if matches:
print matches.group(1)
someDomainName
In the above example, you won't have groups - 2, 3 and 4, as in the previous example, as we have captured only 1 group.. And yes group 0 is always captured.. That is the complete string that matches..
Yeah, your simplest bet is regex. Here's something that will probably get the job done:
import re
matcher = re.compile(r'www.(.+).com\/(.+)
matches = matcher.search(yourstring)
if matches:
str1,str2 = matches.groups()
If you are sure that there are no dots in SomeDomainName you can just take the first occurence of the string ".com/" and take everything from that index on
this will avoid you the use of regex which are harder to maintain
exp = 'http://www.aejlidjaelidjl.com/alieilael'
print exp[exp.find('.com/')+5:]
How can I use regex in python to capture something between two strings or phrases, and removing everything else on the line?
For example, the following is a protein sequence preceded by a one-line header. How can I sift off "CG33289-PC" from the header below based on the stipulation that is occurs after the phrase "FlyBase_Annotation_IDs:" and before the next comma "," ?
I need to substitute the header with this simplified result "CG33289-PC" and not destroy the protein sequence (found below the header-line in all caps).
This is what each protein sequence entry looks like - a header followed by a sequence:
>FBpp0293870 type=protein;loc=3L:join(21527760..21527913,21527977..21528076,21528130..21528390,21528443..21528653,21528712..21529192,21529254..21529264); ID=FBpp0293870; name=CG33289-PC; parent=FBgn0053289,FBtr0305327; dbxref=FlyBase:FBpp0293870,FlyBase_Annotation_IDs:CG33289-PC; MD5=478485a27487608aa2b6c35d39a3295c; length=405; release=r5.45; species=Dmel;
MEMLKYVISDNNYSWWIKLYFAIIFALVLFVAVNLAVGIYNKWDSTPVII
GISSKMTPIDQIPFPTITVCNMNQAKKSKVEHLMPGSIRYAMLQKTCYKE
SNFSQYMDTQHRNETFSNFILDVSEKCADLIVSCIFHQQRIPCTDIFRET
FVDEGLCCIFNVLHPYYLYKFKSPYIRDFTSSDRFADIAVDWDPISGYPQ
RLPSSYYPRPGVGVGTSMGLQIVLNGHVDDYFCSSTNGQGFKILLYNPID
QPRMKESGLPVMIGHQTSFRIIARNVEATPSIRNIHRTKRQCIFSDEQEL
LFYRYYTRRNCEAECDSMFFLRLCSCIPYYLPLIYPNASVCDVFHFECLN
RAESQIFDLQSSQCKEFCLTSCHDLIFFPDAFSTPFSQKDVKAQTNYLTN
FSRAV
This is the desired output:
CG33289-PC
MEMLKYVISDNNYSWWIKLYFAIIFALVLFVAVNLAVGIYNKWDSTPVII
GISSKMTPIDQIPFPTITVCNMNQAKKSKVEHLMPGSIRYAMLQKTCYKE
SNFSQYMDTQHRNETFSNFILDVSEKCADLIVSCIFHQQRIPCTDIFRET
FVDEGLCCIFNVLHPYYLYKFKSPYIRDFTSSDRFADIAVDWDPISGYPQ
RLPSSYYPRPGVGVGTSMGLQIVLNGHVDDYFCSSTNGQGFKILLYNPID
QPRMKESGLPVMIGHQTSFRIIARNVEATPSIRNIHRTKRQCIFSDEQEL
LFYRYYTRRNCEAECDSMFFLRLCSCIPYYLPLIYPNASVCDVFHFECLN
RAESQIFDLQSSQCKEFCLTSCHDLIFFPDAFSTPFSQKDVKAQTNYLTN
FSRAV
Using regexps:
>>> s = """>FBpp0293870 type=protein;loc=3L:join(21527760..21527913,21527977..21528076,21528130..21528390,21528443..21528653,21528712..21529192,21529254..21529264); ID=FBpp0293870; name=CG33289-PC; parent=FBgn0053289,FBtr0305327; dbxref=FlyBase:FBpp0293870,FlyBase_Annotation_IDs:CG33289-PC; MD5=478485a27487608aa2b6c35d39a3295c; length=405; release=r5.45; species=Dmel; MEMLKYVISDNNYSWWIKLYFAIIFALVLFVAVNLAVGIYNKWDSTPVII
GISSKMTPIDQIPFPTITVCNMNQAKKSKVEHLMPGSIRYAMLQKTCYKE
SNFSQYMDTQHRNETFSNFILDVSEKCADLIVSCIFHQQRIPCTDIFRET
FVDEGLCCIFNVLHPYYLYKFKSPYIRDFTSSDRFADIAVDWDPISGYPQ
RLPSSYYPRPGVGVGTSMGLQIVLNGHVDDYFCSSTNGQGFKILLYNPID
QPRMKESGLPVMIGHQTSFRIIARNVEATPSIRNIHRTKRQCIFSDEQEL
LFYRYYTRRNCEAECDSMFFLRLCSCIPYYLPLIYPNASVCDVFHFECLN
RAESQIFDLQSSQCKEFCLTSCHDLIFFPDAFSTPFSQKDVKAQTNYLTN
FSRAV"""
>>> import re
>>> print re.sub(r'.*FlyBase_Annotation_IDs:([\w-]+).*;', r'\1\n', s)
CG33289-PC
MEMLKYVISDNNYSWWIKLYFAIIFALVLFVAVNLAVGIYNKWDSTPVII
GISSKMTPIDQIPFPTITVCNMNQAKKSKVEHLMPGSIRYAMLQKTCYKE
SNFSQYMDTQHRNETFSNFILDVSEKCADLIVSCIFHQQRIPCTDIFRET
FVDEGLCCIFNVLHPYYLYKFKSPYIRDFTSSDRFADIAVDWDPISGYPQ
RLPSSYYPRPGVGVGTSMGLQIVLNGHVDDYFCSSTNGQGFKILLYNPID
QPRMKESGLPVMIGHQTSFRIIARNVEATPSIRNIHRTKRQCIFSDEQEL
LFYRYYTRRNCEAECDSMFFLRLCSCIPYYLPLIYPNASVCDVFHFECLN
RAESQIFDLQSSQCKEFCLTSCHDLIFFPDAFSTPFSQKDVKAQTNYLTN
FSRAV
>>>
Not an elegant solution, but this should work for you:
>>> fly = 'FlyBase_Annotation_IDs'
>>> repl = 'CG33289-PC'
>>> part1, part2 = protein.split(fly)
>>> part2 = part2.replace(repl, "FooBar")
>>> protein = fly.join([part1, part2])
assuming FlyBase_Annotation_IDs can only appear once in the data.
I'm not sure about the format of the file, but this regex will capture the data in your example:
"FlyBase_Annotation_IDs:([A-Z0-9a-z-]*);"
Use findall function to get the match.
Assuming there is a newline after the header:
>>> import re
>>> protein = "..."
>>> r = re.compile(r"^.*FlyBase_Annotation_IDs:([A-Z0-9a-z-]*);.*$", re.MULTILINE)
>>> r.sub(r"\1", protein)
The group ([A-Z0-9a-z-]*) in the regular expression extracts any alphanumeric character and the dash. If ids can have other characters, just add them.
I need to remove all special characters, punctuation and spaces from a string so that I only have letters and numbers.
This can be done without regex:
>>> string = "Special $#! characters spaces 888323"
>>> ''.join(e for e in string if e.isalnum())
'Specialcharactersspaces888323'
You can use str.isalnum:
S.isalnum() -> bool
Return True if all characters in S are alphanumeric
and there is at least one character in S, False otherwise.
If you insist on using regex, other solutions will do fine. However note that if it can be done without using a regular expression, that's the best way to go about it.
Here is a regex to match a string of characters that are not a letters or numbers:
[^A-Za-z0-9]+
Here is the Python command to do a regex substitution:
re.sub('[^A-Za-z0-9]+', '', mystring)
Shorter way :
import re
cleanString = re.sub('\W+','', string )
If you want spaces between words and numbers substitute '' with ' '
TLDR
I timed the provided answers.
import re
re.sub('\W+','', string)
is typically 3x faster than the next fastest provided top answer.
Caution should be taken when using this option. Some special characters (e.g. ø) may not be striped using this method.
After seeing this, I was interested in expanding on the provided answers by finding out which executes in the least amount of time, so I went through and checked some of the proposed answers with timeit against two of the example strings:
string1 = 'Special $#! characters spaces 888323'
string2 = 'how much for the maple syrup? $20.99? That s ridiculous!!!'
Example 1
'.join(e for e in string if e.isalnum())
string1 - Result: 10.7061979771
string2 - Result: 7.78372597694
Example 2
import re
re.sub('[^A-Za-z0-9]+', '', string)
string1 - Result: 7.10785102844
string2 - Result: 4.12814903259
Example 3
import re
re.sub('\W+','', string)
string1 - Result: 3.11899876595
string2 - Result: 2.78014397621
The above results are a product of the lowest returned result from an average of: repeat(3, 2000000)
Example 3 can be 3x faster than Example 1.
Python 2.*
I think just filter(str.isalnum, string) works
In [20]: filter(str.isalnum, 'string with special chars like !,#$% etcs.')
Out[20]: 'stringwithspecialcharslikeetcs'
Python 3.*
In Python3, filter( ) function would return an itertable object (instead of string unlike in above). One has to join back to get a string from itertable:
''.join(filter(str.isalnum, string))
or to pass list in join use (not sure but can be fast a bit)
''.join([*filter(str.isalnum, string)])
note: unpacking in [*args] valid from Python >= 3.5
#!/usr/bin/python
import re
strs = "how much for the maple syrup? $20.99? That's ricidulous!!!"
print strs
nstr = re.sub(r'[?|$|.|!]',r'',strs)
print nstr
nestr = re.sub(r'[^a-zA-Z0-9 ]',r'',nstr)
print nestr
you can add more special character and that will be replaced by '' means nothing i.e they will be removed.
Differently than everyone else did using regex, I would try to exclude every character that is not what I want, instead of enumerating explicitly what I don't want.
For example, if I want only characters from 'a to z' (upper and lower case) and numbers, I would exclude everything else:
import re
s = re.sub(r"[^a-zA-Z0-9]","",s)
This means "substitute every character that is not a number, or a character in the range 'a to z' or 'A to Z' with an empty string".
In fact, if you insert the special character ^ at the first place of your regex, you will get the negation.
Extra tip: if you also need to lowercase the result, you can make the regex even faster and easier, as long as you won't find any uppercase now.
import re
s = re.sub(r"[^a-z0-9]","",s.lower())
string.punctuation contains following characters:
'!"#$%&\'()*+,-./:;<=>?#[\]^_`{|}~'
You can use translate and maketrans functions to map punctuations to empty values (replace)
import string
'This, is. A test!'.translate(str.maketrans('', '', string.punctuation))
Output:
'This is A test'
s = re.sub(r"[-()\"#/#;:<>{}`+=~|.!?,]", "", s)
Assuming you want to use a regex and you want/need Unicode-cognisant 2.x code that is 2to3-ready:
>>> import re
>>> rx = re.compile(u'[\W_]+', re.UNICODE)
>>> data = u''.join(unichr(i) for i in range(256))
>>> rx.sub(u'', data)
u'0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz\xaa\xb2 [snip] \xfe\xff'
>>>
The most generic approach is using the 'categories' of the unicodedata table which classifies every single character. E.g. the following code filters only printable characters based on their category:
import unicodedata
# strip of crap characters (based on the Unicode database
# categorization:
# http://www.sql-und-xml.de/unicode-database/#kategorien
PRINTABLE = set(('Lu', 'Ll', 'Nd', 'Zs'))
def filter_non_printable(s):
result = []
ws_last = False
for c in s:
c = unicodedata.category(c) in PRINTABLE and c or u'#'
result.append(c)
return u''.join(result).replace(u'#', u' ')
Look at the given URL above for all related categories. You also can of course filter
by the punctuation categories.
For other languages like German, Spanish, Danish, French etc that contain special characters (like German "Umlaute" as ü, ä, ö) simply add these to the regex search string:
Example for German:
re.sub('[^A-ZÜÖÄa-z0-9]+', '', mystring)
This will remove all special characters, punctuation, and spaces from a string and only have numbers and letters.
import re
sample_str = "Hel&&lo %% Wo$#rl#d"
# using isalnum()
print("".join(k for k in sample_str if k.isalnum()))
# using regex
op2 = re.sub("[^A-Za-z]", "", sample_str)
print(f"op2 = ", op2)
special_char_list = ["$", "#", "#", "&", "%"]
# using list comprehension
op1 = "".join([k for k in sample_str if k not in special_char_list])
print(f"op1 = ", op1)
# using lambda function
op3 = "".join(filter(lambda x: x not in special_char_list, sample_str))
print(f"op3 = ", op3)
Use translate:
import string
def clean(instr):
return instr.translate(None, string.punctuation + ' ')
Caveat: Only works on ascii strings.
This will remove all non-alphanumeric characters except spaces.
string = "Special $#! characters spaces 888323"
''.join(e for e in string if (e.isalnum() or e.isspace()))
Special characters spaces 888323
import re
my_string = """Strings are amongst the most popular data types in Python. We can create the strings by enclosing characters in quotes. Python treats single quotes the
same as double quotes."""
# if we need to count the word python that ends with or without ',' or '.' at end
count = 0
for i in text:
if i.endswith("."):
text[count] = re.sub("^([a-z]+)(.)?$", r"\1", i)
count += 1
print("The count of Python : ", text.count("python"))
After 10 Years, below I wrote there is the best solution.
You can remove/clean all special characters, punctuation, ASCII characters and spaces from the string.
from clean_text import clean
string = 'Special $#! characters spaces 888323'
new = clean(string,lower=False,no_currency_symbols=True, no_punct = True,replace_with_currency_symbol='')
print(new)
Output ==> 'Special characters spaces 888323'
you can replace space if you want.
update = new.replace(' ','')
print(update)
Output ==> 'Specialcharactersspaces888323'
function regexFuntion(st) {
const regx = /[^\w\s]/gi; // allow : [a-zA-Z0-9, space]
st = st.replace(regx, ''); // remove all data without [a-zA-Z0-9, space]
st = st.replace(/\s\s+/g, ' '); // remove multiple space
return st;
}
console.log(regexFuntion('$Hello; # -world--78asdf+-===asdflkj******lkjasdfj67;'));
// Output: Hello world78asdfasdflkjlkjasdfj67
import re
abc = "askhnl#$%askdjalsdk"
ddd = abc.replace("#$%","")
print (ddd)
and you shall see your result as
'askhnlaskdjalsdk