I have a string like: The old man $went$ to the $barn$. How would I convert this to The old man ~!went! to the ~!barn!.
If I didn't need to add the ~ in front of the first occurrence, I could simply do text.replace('$', '!') in Python.
Use a capture group so that your replacement string can put the text between the $ back in place.
So the regex would be:
\$([^$]*)\$
And then the replacement string would be:
~!\1!
Regex101 Demo
Yes, regex this. Capture groups will help.
result = re.sub(r'\$(.*?)\$', r'~!\1!', my_str)
Probably regex capturing group is the way to go here, but here a simple way to do it without regex:
>>> s
'The old man $went$ to the $barn$'
>>> r
''
>>> seen = False
>>>
>>> for c in s:
if c=='$':
if seen:
r +='!'
seen = False
else:
r +='~!'
seen=True
else:
r += c
>>> r
'The old man ~!went! to the ~!barn!'
Related
I have a string:
ostring = "Ref('r1_featuring', ObjectId('5f475')"
What I am trying to do is search the string and check if it starts with Ref, if it does it should remove everything in the string and keep the substring 5f475.
I know this can be done using a simple replace like so:
string = ostring.replace("Ref('r1_featuring', ObjectId('", '').replace("')", '')
But I cannot do it this way as it needs to all be dynamic as there are going to be different strings each time. So I need to do it in a way that it will search the string and check if it starts with Ref, if it does then grab the alphanumeric value.
Desired Output:
5f475
Any help will be appreciated.
Like that?
>>> import re
>>> pattern = r"Ref.*'(.*)'\)$"
>>> m = re.match(pattern, "Ref('r1_featuring', ObjectId('5f475')")
>>> if m:
... print(m.group(1))
...
5f475
# >= python3.8
>>> if m := re.match(pattern, "Ref('r1_featuring', ObjectId('5f475')"):
... print(m.group(1))
...
5f475
a regex-free solution :)
ostring = "Ref('r1_featuring', ObjectId('5f475')"
if ostring.startswith("Ref"):
desired_part = ostring.rpartition("('")[-1].rpartition("')")[0]
str.rpartition
For example, I have a string:
The struct-of-application and struct-of-world
With re.sub, it will replace the matched with a predefined string. How can I replace the match with a transformation of the matched content? To get, for example:
The [application_of_struct](http://application_of_struct) and [world-of-struct](http://world-of-struct)
If I write a simple regex ((\w+-)+\w+) and try to use re.sub, it seems I can't use what I matched as part of the replacement, let alone edit the matched content:
In [10]: p.sub('struct','The struct-of-application and struct-of-world')
Out[10]: 'The struct and struct'
Use a function for the replacement
s = 'The struct-of-application and struct-of-world'
p = re.compile('((\w+-)+\w+)')
def replace(match):
return 'http://{}'.format(match.group())
#for python 3.6+ ...
#return f'http://{match.group()}'
>>> p.sub(replace, s)
'The http://struct-of-application and http://struct-of-world'
>>>
Try this:
>>> p = re.compile(r"((\w+-)+\w+)")
>>> p.sub('[\\1](http://\\1)','The struct-of-application and struct-of-world')
'The [struct-of-application](http://struct-of-application) and [struct-of-world](http://struct-of-world)'
I am trying to write a generic pattern using regex so that it fetches only particular things from the string. Let's say we have strings like GigabitEthernet0/0/0/0 or FastEthernet0/4 or Ethernet0/0.222. The regex should fetch the first 2 characters and all the numerals. Therefore, the fetched result should be something like Gi0000 or Fa04 or Et00222 depending on the above cases.
x = 'GigabitEthernet0/0/0/2
m = re.search('([\w+]{2}?)[\\\.(\d+)]{0,}',x)
I am not able to understand how shall I write the regular expression. The values can be fetched in the form of a list also. I write few more patterns but it isn't helping.
In regex, you may use re.findall function.
>>> import re
>>> s = 'GigabitEthernet0/0/0/0 '
>>> s[:2]+''.join(re.findall(r'\d', s))
'Gi0000'
OR
>>> ''.join(re.findall(r'^..|\d', s))
'Gi0000'
>>> ''.join(re.findall(r'^..|\d', 'Ethernet0/0.222'))
'Et00222'
OR
>>> s = 'GigabitEthernet0/0/0/0 '
>>> s[:2]+''.join([i for i in s if i.isdigit()])
'Gi0000'
z="Ethernet0/0.222."
print z[:2]+"".join(re.findall(r"(\d+)(?=[\d\W]*$)",z))
You can try this.This will make sure only digits from end come into play .
Here is another option:
s = 'Ethernet0/0.222'
"".join(re.findall('^\w{2}|[\d]+', s))
How can I use regex in python to capture something between two strings or phrases, and removing everything else on the line?
For example, the following is a protein sequence preceded by a one-line header. How can I sift off "CG33289-PC" from the header below based on the stipulation that is occurs after the phrase "FlyBase_Annotation_IDs:" and before the next comma "," ?
I need to substitute the header with this simplified result "CG33289-PC" and not destroy the protein sequence (found below the header-line in all caps).
This is what each protein sequence entry looks like - a header followed by a sequence:
>FBpp0293870 type=protein;loc=3L:join(21527760..21527913,21527977..21528076,21528130..21528390,21528443..21528653,21528712..21529192,21529254..21529264); ID=FBpp0293870; name=CG33289-PC; parent=FBgn0053289,FBtr0305327; dbxref=FlyBase:FBpp0293870,FlyBase_Annotation_IDs:CG33289-PC; MD5=478485a27487608aa2b6c35d39a3295c; length=405; release=r5.45; species=Dmel;
MEMLKYVISDNNYSWWIKLYFAIIFALVLFVAVNLAVGIYNKWDSTPVII
GISSKMTPIDQIPFPTITVCNMNQAKKSKVEHLMPGSIRYAMLQKTCYKE
SNFSQYMDTQHRNETFSNFILDVSEKCADLIVSCIFHQQRIPCTDIFRET
FVDEGLCCIFNVLHPYYLYKFKSPYIRDFTSSDRFADIAVDWDPISGYPQ
RLPSSYYPRPGVGVGTSMGLQIVLNGHVDDYFCSSTNGQGFKILLYNPID
QPRMKESGLPVMIGHQTSFRIIARNVEATPSIRNIHRTKRQCIFSDEQEL
LFYRYYTRRNCEAECDSMFFLRLCSCIPYYLPLIYPNASVCDVFHFECLN
RAESQIFDLQSSQCKEFCLTSCHDLIFFPDAFSTPFSQKDVKAQTNYLTN
FSRAV
This is the desired output:
CG33289-PC
MEMLKYVISDNNYSWWIKLYFAIIFALVLFVAVNLAVGIYNKWDSTPVII
GISSKMTPIDQIPFPTITVCNMNQAKKSKVEHLMPGSIRYAMLQKTCYKE
SNFSQYMDTQHRNETFSNFILDVSEKCADLIVSCIFHQQRIPCTDIFRET
FVDEGLCCIFNVLHPYYLYKFKSPYIRDFTSSDRFADIAVDWDPISGYPQ
RLPSSYYPRPGVGVGTSMGLQIVLNGHVDDYFCSSTNGQGFKILLYNPID
QPRMKESGLPVMIGHQTSFRIIARNVEATPSIRNIHRTKRQCIFSDEQEL
LFYRYYTRRNCEAECDSMFFLRLCSCIPYYLPLIYPNASVCDVFHFECLN
RAESQIFDLQSSQCKEFCLTSCHDLIFFPDAFSTPFSQKDVKAQTNYLTN
FSRAV
Using regexps:
>>> s = """>FBpp0293870 type=protein;loc=3L:join(21527760..21527913,21527977..21528076,21528130..21528390,21528443..21528653,21528712..21529192,21529254..21529264); ID=FBpp0293870; name=CG33289-PC; parent=FBgn0053289,FBtr0305327; dbxref=FlyBase:FBpp0293870,FlyBase_Annotation_IDs:CG33289-PC; MD5=478485a27487608aa2b6c35d39a3295c; length=405; release=r5.45; species=Dmel; MEMLKYVISDNNYSWWIKLYFAIIFALVLFVAVNLAVGIYNKWDSTPVII
GISSKMTPIDQIPFPTITVCNMNQAKKSKVEHLMPGSIRYAMLQKTCYKE
SNFSQYMDTQHRNETFSNFILDVSEKCADLIVSCIFHQQRIPCTDIFRET
FVDEGLCCIFNVLHPYYLYKFKSPYIRDFTSSDRFADIAVDWDPISGYPQ
RLPSSYYPRPGVGVGTSMGLQIVLNGHVDDYFCSSTNGQGFKILLYNPID
QPRMKESGLPVMIGHQTSFRIIARNVEATPSIRNIHRTKRQCIFSDEQEL
LFYRYYTRRNCEAECDSMFFLRLCSCIPYYLPLIYPNASVCDVFHFECLN
RAESQIFDLQSSQCKEFCLTSCHDLIFFPDAFSTPFSQKDVKAQTNYLTN
FSRAV"""
>>> import re
>>> print re.sub(r'.*FlyBase_Annotation_IDs:([\w-]+).*;', r'\1\n', s)
CG33289-PC
MEMLKYVISDNNYSWWIKLYFAIIFALVLFVAVNLAVGIYNKWDSTPVII
GISSKMTPIDQIPFPTITVCNMNQAKKSKVEHLMPGSIRYAMLQKTCYKE
SNFSQYMDTQHRNETFSNFILDVSEKCADLIVSCIFHQQRIPCTDIFRET
FVDEGLCCIFNVLHPYYLYKFKSPYIRDFTSSDRFADIAVDWDPISGYPQ
RLPSSYYPRPGVGVGTSMGLQIVLNGHVDDYFCSSTNGQGFKILLYNPID
QPRMKESGLPVMIGHQTSFRIIARNVEATPSIRNIHRTKRQCIFSDEQEL
LFYRYYTRRNCEAECDSMFFLRLCSCIPYYLPLIYPNASVCDVFHFECLN
RAESQIFDLQSSQCKEFCLTSCHDLIFFPDAFSTPFSQKDVKAQTNYLTN
FSRAV
>>>
Not an elegant solution, but this should work for you:
>>> fly = 'FlyBase_Annotation_IDs'
>>> repl = 'CG33289-PC'
>>> part1, part2 = protein.split(fly)
>>> part2 = part2.replace(repl, "FooBar")
>>> protein = fly.join([part1, part2])
assuming FlyBase_Annotation_IDs can only appear once in the data.
I'm not sure about the format of the file, but this regex will capture the data in your example:
"FlyBase_Annotation_IDs:([A-Z0-9a-z-]*);"
Use findall function to get the match.
Assuming there is a newline after the header:
>>> import re
>>> protein = "..."
>>> r = re.compile(r"^.*FlyBase_Annotation_IDs:([A-Z0-9a-z-]*);.*$", re.MULTILINE)
>>> r.sub(r"\1", protein)
The group ([A-Z0-9a-z-]*) in the regular expression extracts any alphanumeric character and the dash. If ids can have other characters, just add them.
I am working with a text where all "\n"s have been deleted (which merges two words into one, like "I like bananasAnd this is a new line.And another one.") What I would like to do now is tell Python to look for combinations of a small letter followed by capital letter/punctuation followed by capital letter and insert a whitespace.
I thought this would be easy with reg. expressions, but it is not - I couldnt find an "insert" function or anything, and the string commands seem not to be helpful either. How do I do this?
Any help would be greatly appreciated, I am despairing over here...
Thanks, patrick
Try the following:
re.sub(r"([a-z\.!?])([A-Z])", r"\1 \2", your_string)
For example:
import re
lines = "I like bananasAnd this is a new line.And another one."
print re.sub(r"([a-z\.!?])([A-Z])", r"\1 \2", lines)
# I like bananas And this is a new line. And another one.
If you want to insert a newline instead of a space, change the replacement to r"\1\n\2".
Using re.sub you should be able to make a pattern that grabs a lowercase and uppercase letter and substitutes them for the same two letters, but with a space in between:
import re
re.sub(r'([a-z][.?]?)([A-Z])', '\\1\n\\2', mystring)
You're looking for the sub function. See http://docs.python.org/library/re.html for documentation.
Hmm, interesting. You can use regular expressions to replace text with the sub() function:
>>> import re
>>> string = 'fooBar'
>>> re.sub(r'([a-z][.!?]*)([A-Z])', r'\1 \2', string)
'foo Bar'
If you really don't have any caps except at the beginning of a sentence, it will probably be easiest to just loop through the string.
>>> import string
>>> s = "a word endsA new sentence"
>>> lastend = 0
>>> sentences = list()
>>> for i in range(0, len(s)):
... if s[i] in string.uppercase:
... sentences.append(s[lastend:i])
... lastend = i
>>> sentences.append(s[lastend:])
>>> print sentences
['a word ends', 'A new sentence']
Here's another approach, which avoids regular expressions and does not use any imported libraries, just built-ins...
s = "I like bananasAnd this is a new line.And another one."
with_whitespace = ''
last_was_upper = True
for c in s:
if c.isupper():
if not last_was_upper:
with_whitespace += ' '
last_was_upper = True
else:
last_was_upper = False
with_whitespace += c
print with_whitespace
Yields:
I like bananas And this is a new line. And another one.